Lineage for d2hgsa2 (2hgs A:304-474)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36227Family d.142.1.6: Eukaryotic glutathione synthetase [56088] (1 protein)
  6. 36228Protein Eukaryotic glutathione synthetase [56089] (1 species)
  7. 36229Species Human (Homo sapiens) [TaxId:9606] [56090] (1 PDB entry)
  8. 36230Domain d2hgsa2: 2hgs A:304-474 [41575]
    Other proteins in same PDB: d2hgsa1

Details for d2hgsa2

PDB Entry: 2hgs (more details), 2.1 Å

PDB Description: human glutathione synthetase

SCOP Domain Sequences for d2hgsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgsa2 d.142.1.6 (A:304-474) Eukaryotic glutathione synthetase {Human (Homo sapiens)}
tkkvqqelsrpgmlemllpgqpeavarlratfaglysldvgeegdqaiaealaapsrfvl
kpqregggnnlygeemvqalkqlkdseerasyilmekiepepfencllrpgsparvvqci
selgifgvyvrqektlvmnkhvghllrtkaiehadggvaagvavldnpypv

SCOP Domain Coordinates for d2hgsa2:

Click to download the PDB-style file with coordinates for d2hgsa2.
(The format of our PDB-style files is described here.)

Timeline for d2hgsa2: