SCOPe 2.01: Domain d1scub2: 1scu B:1-238

Lineage for d1scub2 (1scu B:1-238)

Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamilies
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families)
Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
Domain d1scub2: 1scu B:1-238 [41566]
Other proteins in same PDB: d1scua1, d1scua2, d1scub1, d1scud1, d1scud2, d1scue1
complexed with coa

Details for d1scub2

PDB Entry: 1scu (more details), 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

PDB Compounds: (B:) succinyl-coa synthetase, beta subunit

SCOPe Domain Sequences for d1scub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scub2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOPe Domain Coordinates for d1scub2:

Click to download the PDB-style file with coordinates for d1scub2.
(The format of our PDB-style files is described here.)

Timeline for d1scub2: