Lineage for d1scub2 (1scu B:1-238)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36207Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
  6. 36208Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 36209Species Escherichia coli [TaxId:562] [56083] (4 PDB entries)
  8. 36214Domain d1scub2: 1scu B:1-238 [41566]
    Other proteins in same PDB: d1scua1, d1scua2, d1scub1, d1scud1, d1scud2, d1scue1

Details for d1scub2

PDB Entry: 1scu (more details), 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

SCOP Domain Sequences for d1scub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scub2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOP Domain Coordinates for d1scub2:

Click to download the PDB-style file with coordinates for d1scub2.
(The format of our PDB-style files is described here.)

Timeline for d1scub2: