Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species) |
Species Escherichia coli [TaxId:562] [52213] (11 PDB entries) |
Domain d1scud2: 1scu D:122-288 [31136] Other proteins in same PDB: d1scua1, d1scub1, d1scub2, d1scud1, d1scue1, d1scue2 complexed with coa |
PDB Entry: 1scu (more details), 2.5 Å
SCOPe Domain Sequences for d1scud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1scud2 c.23.4.1 (D:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]} ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk
Timeline for d1scud2: