Lineage for d1fo4a5 (1fo4 A:695-1332)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 2540572Protein Xanthine oxidase, C-terminal domain [56008] (1 species)
  7. 2540573Species Cow (Bos taurus) [TaxId:9913] [56009] (11 PDB entries)
    Uniprot P80457
  8. 2540590Domain d1fo4a5: 1fo4 A:695-1332 [41416]
    Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a4, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b4, d1fo4b6
    complexed with ca, fad, fes, gol, mos, mte, sal

Details for d1fo4a5

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1fo4a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4a5 d.133.1.1 (A:695-1332) Xanthine oxidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkfttlcvtgapgnckpwslrv

SCOPe Domain Coordinates for d1fo4a5:

Click to download the PDB-style file with coordinates for d1fo4a5.
(The format of our PDB-style files is described here.)

Timeline for d1fo4a5: