Lineage for d1fo4b1 (1fo4 B:93-165)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715311Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 2715312Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
    Uniprot P80457
  8. 2715330Domain d1fo4b1: 1fo4 B:93-165 [17911]
    Other proteins in same PDB: d1fo4a2, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b2, d1fo4b3, d1fo4b4, d1fo4b5, d1fo4b6
    complexed with ca, fad, fes, gol, mos, mte, sal

Details for d1fo4b1

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1fo4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4b1 a.56.1.1 (B:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d1fo4b1:

Click to download the PDB-style file with coordinates for d1fo4b1.
(The format of our PDB-style files is described here.)

Timeline for d1fo4b1: