| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) ![]() automatically mapped to Pfam PF03450 |
| Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
| Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries) Uniprot P80457 |
| Domain d1fo4a4: 1fo4 A:415-531 [40227] Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b5, d1fo4b6 complexed with ca, fad, fes, gol, mos, mte, sal |
PDB Entry: 1fo4 (more details), 2.1 Å
SCOPe Domain Sequences for d1fo4a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo4a4 d.87.2.1 (A:415-531) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkds
Timeline for d1fo4a4: