PDB entry 1fo4

View 1fo4 on RCSB PDB site
Description: crystal structure of xanthine dehydrogenase isolated from bovine milk
Class: oxidoreductase
Keywords: Xanthine Dehydrogenase, FAD, molybdopterin, 2Fe-2S iron sulfur centers, salicylate, OXIDOREDUCTASE
Deposited on 2000-08-24, released 2000-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fo4A (A:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqas
    tlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfg
    aacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisd
    lnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsa
    fkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwne
    kllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldp
    tytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddiprye
    nelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtv
    tcvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlk
    kgfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakml
    gvpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrh
    pflarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrl
    cktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrle
    gfsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagal
    ihvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaas
    vstdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgy
    sfetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafv
    qglglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavg
    epplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtg
    apgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fo4A (A:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakspslfnpeefmpldptq
    epifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiem
    kfknqlfpmiicpawipelnavehgpegisfgaacalssvektlleavaklptqktevfr
    gvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdht
    ffpsyrktllgpeeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmq
    vkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefr
    rtltlsfffkfyltvlkklgkdskldptytsatllfqkhppaniqlfqevpngqskedtv
    grplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvc
    flsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlp
    aiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaip
    kgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvava
    laayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdl
    shsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavt
    cglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencw
    kkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaska
    lkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgsw
    edwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhkn
    lrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafg
    siptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkel
    frldspatpekirnacvdkfttlcvtgapgnckpwslrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fo4B (B:)
    mtadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydr
    lqdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgi
    vmsmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpncc
    mnqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqas
    tlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfg
    aacalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisd
    lnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsa
    fkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwne
    kllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldp
    tytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddiprye
    nelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtv
    tcvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlk
    kgfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakml
    gvpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrh
    pflarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrl
    cktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrle
    gfsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagal
    ihvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaas
    vstdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgy
    sfetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafv
    qglglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavg
    epplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtg
    apgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fo4B (B:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakspslfnpeefmpldptq
    epifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiem
    kfknqlfpmiicpawipelnavehgpegisfgaacalssvektlleavaklptqktevfr
    gvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdht
    ffpsyrktllgpeeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmq
    vkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefr
    rtltlsfffkfyltvlkklgkldptytsatllfqkhppaniqlfqevpngqskedtvgrp
    lphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvcfls
    addipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlpaii
    tiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipkge
    egemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvavalaa
    yktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdlshs
    imeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtcgl
    paeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwkkr
    glciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskalki
    piskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswedw
    vmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknlrt
    divmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgsip
    tefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelfrl
    dspatpekirnacvdkfttlcvtgapgnckpwslrv