| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) |
Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins) |
| Protein gp45 sliding clamp [55984] (2 species) |
| Species Bacteriophage T4 [TaxId:10665] [55986] (1 PDB entry) |
| Domain d1czdc1: 1czd C:3001-3110 [41378] |
PDB Entry: 1czd (more details), 2.45 Å
SCOP Domain Sequences for d1czdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czdc1 d.131.1.2 (C:3001-3110) gp45 sliding clamp {Bacteriophage T4}
mklskdttallknfatinsgimlksgqfimtravngttyaeanisdvidfdvaiydlngf
lgilslvnddaeisqsedgnikiadarstifwpaadpstvvapnkpipfp
Timeline for d1czdc1:
View in 3DDomains from other chains: (mouse over for more information) d1czda1, d1czda2, d1czdb1, d1czdb2 |