Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
Protein Retroviral integrase, catalytic domain [53108] (5 species) |
Species Human spumaretrovirus [TaxID:11963] [419615] (6 PDB entries) |
Domain d3l2ua2: 3l2u A:107-315 [413300] Other proteins in same PDB: d3l2ua1, d3l2ua3 automated match to d3l2qa1 protein/DNA complex; complexed with elv, gol, mg, nh4, zn |
PDB Entry: 3l2u (more details), 3.15 Å
SCOPe Domain Sequences for d3l2ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2ua2 c.55.3.2 (A:107-315) Retroviral integrase, catalytic domain {Human spumaretrovirus [TaxID:11963]} kasgpilrpdrpqkpfdkffidyigplppsqgylyvlvvvdgmtgftwlyptkapstsat vkslnvltsiaipkvihsdqgaaftsstfaewakergihlefstpyhpqssgkverknsd ikrlltkllvgrptkwydllpvvqlalnntyspvlkytphqllfgidsntpfanqdtldl treeelsllqeirtslyhpstppassrsw
Timeline for d3l2ua2: