Lineage for d3l2ua2 (3l2u A:107-315)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886114Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. 2886237Species Human spumaretrovirus [TaxID:11963] [419615] (6 PDB entries)
  8. 2886241Domain d3l2ua2: 3l2u A:107-315 [413300]
    Other proteins in same PDB: d3l2ua1, d3l2ua3
    automated match to d3l2qa1
    protein/DNA complex; complexed with elv, gol, mg, nh4, zn

Details for d3l2ua2

PDB Entry: 3l2u (more details), 3.15 Å

PDB Description: Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium and GS9137 (Elvitegravir)
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d3l2ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2ua2 c.55.3.2 (A:107-315) Retroviral integrase, catalytic domain {Human spumaretrovirus [TaxID:11963]}
kasgpilrpdrpqkpfdkffidyigplppsqgylyvlvvvdgmtgftwlyptkapstsat
vkslnvltsiaipkvihsdqgaaftsstfaewakergihlefstpyhpqssgkverknsd
ikrlltkllvgrptkwydllpvvqlalnntyspvlkytphqllfgidsntpfanqdtldl
treeelsllqeirtslyhpstppassrsw

SCOPe Domain Coordinates for d3l2ua2:

Click to download the PDB-style file with coordinates for d3l2ua2.
(The format of our PDB-style files is described here.)

Timeline for d3l2ua2:

  • d3l2ua2 is new in SCOPe 2.08-stable