Lineage for d3l2ua3 (3l2u A:316-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784433Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) (S)
  5. 2784434Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
    Pfam PF00552, Pfam PF18103
  6. 2784435Protein DNA-binding domain of retroviral integrase [50124] (4 species)
  7. 2784452Species Human spumaretrovirus [TaxID:11963] [419616] (6 PDB entries)
  8. 2784456Domain d3l2ua3: 3l2u A:316-374 [413301]
    Other proteins in same PDB: d3l2ua1, d3l2ua2
    automated match to d3l2qa2
    protein/DNA complex; complexed with elv, gol, mg, nh4, zn

Details for d3l2ua3

PDB Entry: 3l2u (more details), 3.15 Å

PDB Description: Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium and GS9137 (Elvitegravir)
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d3l2ua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2ua3 b.34.7.1 (A:316-374) DNA-binding domain of retroviral integrase {Human spumaretrovirus [TaxID:11963]}
spvvgqlvqervarpaslrprwhkpstvlkvlnprtvvildhlgnnrtvsidnlkptsh

SCOPe Domain Coordinates for d3l2ua3:

Click to download the PDB-style file with coordinates for d3l2ua3.
(The format of our PDB-style files is described here.)

Timeline for d3l2ua3:

  • d3l2ua3 is new in SCOPe 2.08-stable