Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) |
Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein) Pfam PF00552, Pfam PF18103 |
Protein DNA-binding domain of retroviral integrase [50124] (4 species) |
Species Human spumaretrovirus [TaxID:11963] [419616] (6 PDB entries) |
Domain d3l2ua3: 3l2u A:316-374 [413301] Other proteins in same PDB: d3l2ua1, d3l2ua2 automated match to d3l2qa2 protein/DNA complex; complexed with elv, gol, mg, nh4, zn |
PDB Entry: 3l2u (more details), 3.15 Å
SCOPe Domain Sequences for d3l2ua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2ua3 b.34.7.1 (A:316-374) DNA-binding domain of retroviral integrase {Human spumaretrovirus [TaxID:11963]} spvvgqlvqervarpaslrprwhkpstvlkvlnprtvvildhlgnnrtvsidnlkptsh
Timeline for d3l2ua3: