Lineage for d1jaw_2 (1jaw 177-440)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35625Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
  4. 35626Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 35627Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 35628Protein Aminopeptidase P, C-terminal domain [55928] (1 species)
  7. 35629Species Escherichia coli [TaxId:562] [55929] (3 PDB entries)
  8. 35632Domain d1jaw_2: 1jaw 177-440 [41166]
    Other proteins in same PDB: d1jaw_1

Details for d1jaw_2

PDB Entry: 1jaw (more details), 2.7 Å

PDB Description: aminopeptidase p from e. coli low ph form

SCOP Domain Sequences for d1jaw_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jaw_2 d.127.1.1 (177-440) Aminopeptidase P, C-terminal domain {Escherichia coli}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOP Domain Coordinates for d1jaw_2:

Click to download the PDB-style file with coordinates for d1jaw_2.
(The format of our PDB-style files is described here.)

Timeline for d1jaw_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jaw_1