Lineage for d1fcba2 (1fcb A:1-97)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35484Fold d.120: Cytochrome b5 [55855] (1 superfamily)
  4. 35485Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 35486Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 35514Protein Flavocytochrome b2, N-terminal domain [55864] (1 species)
  7. 35515Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (4 PDB entries)
  8. 35517Domain d1fcba2: 1fcb A:1-97 [41087]
    Other proteins in same PDB: d1fcba1, d1fcbb1

Details for d1fcba2

PDB Entry: 1fcb (more details), 2.4 Å

PDB Description: molecular structure of flavocytochrome b2 at 2.4 angstroms resolution

SCOP Domain Sequences for d1fcba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcba2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
ifeplhapnvidkyiapekklgplqgsmppelvcppy

SCOP Domain Coordinates for d1fcba2:

Click to download the PDB-style file with coordinates for d1fcba2.
(The format of our PDB-style files is described here.)

Timeline for d1fcba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcba1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fcbb1