Lineage for d5wi9f_ (5wi9 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743062Domain d5wi9f_: 5wi9 F: [410661]
    Other proteins in same PDB: d5wi9e2, d5wi9l2
    automated match to d6shgh_
    complexed with edo, nag, pg4, so4

Details for d5wi9f_

PDB Entry: 5wi9 (more details), 2.7 Å

PDB Description: crystal structure of kl with an agonist fab
PDB Compounds: (F:) 39F7 Fab heavy chain

SCOPe Domain Sequences for d5wi9f_:

Sequence, based on SEQRES records: (download)

>d5wi9f_ b.1.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesgggvvqpgrslrlscaasgftfsnygihwvrqapgkglewvaviwydgsikyya
dsvkgrftisrdnskntlylqmnslraedtavyycardraaaglhyyygmdvwgqgttvt
vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d5wi9f_ b.1.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesgggvvqpgrslrlscaasgftfsnygihwvrqapgkglewvaviwydgsikyya
dsvkgrftisrdnskntlylqmnslraedtavyycardraaaglhyyygmdvwgqgttvt
vssastkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpstqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d5wi9f_:

Click to download the PDB-style file with coordinates for d5wi9f_.
(The format of our PDB-style files is described here.)

Timeline for d5wi9f_:

  • d5wi9f_ is new in SCOPe 2.08-stable