SCOPe 2.08: Domain d5wi9l2: 5wi9 L:108-208

Lineage for d5wi9l2 (5wi9 L:108-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5wi9l2: 5wi9 L:108-208 [355376]
   Other proteins in same PDB: d5wi9e1, d5wi9f_, d5wi9h_, d5wi9l1
   automated match to d1dn0a2
   complexed with edo, nag, pg4, so4

Details for d5wi9l2

PDB Entry: 5wi9, 2.7 Å

PDB Description: crystal structure of kl with an agonist fab

PDB Compounds: (L:) 39F7 Fab light chain

SCOPe Domain Sequences for d5wi9l2:

Sequence, based on SEQRES records:

>d5wi9l2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtk

Sequence, based on observed residues (ATOM records):

>d5wi9l2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreansqesvteqdskdstyslsstl
tlskadycevthqglsspvtk

Timeline for d5wi9l2:

• d5wi9l2 first appeared in SCOPe 2.07