Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d5wi9l2: 5wi9 L:108-208 [355376] Other proteins in same PDB: d5wi9e1, d5wi9f_, d5wi9h_, d5wi9l1 automated match to d1dn0a2 complexed with edo, nag, pg4, so4 |
PDB Entry: 5wi9 (more details), 2.7 Å
SCOPe Domain Sequences for d5wi9l2:
Sequence, based on SEQRES records: (download)
>d5wi9l2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtk
>d5wi9l2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreansqesvteqdskdstyslsstl tlskadycevthqglsspvtk
Timeline for d5wi9l2:
View in 3D Domains from other chains: (mouse over for more information) d5wi9e1, d5wi9e2, d5wi9f_, d5wi9h_ |