Lineage for d2tsrc_ (2tsr C:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261486Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 261487Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 261488Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 261500Protein Thymidylate synthase [55833] (7 species)
  7. 261659Species Rat (Rattus norvegicus) [TaxId:10116] [55839] (2 PDB entries)
  8. 261662Domain d2tsrc_: 2tsr C: [41045]

Details for d2tsrc_

PDB Entry: 2tsr (more details), 2.6 Å

PDB Description: thymidylate synthase from rat in ternary complex with dump and tomudex

SCOP Domain Sequences for d2tsrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tsrc_ d.117.1.1 (C:) Thymidylate synthase {Rat (Rattus norvegicus)}
qhgelqylrqvehimrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgady
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklrilrkvetiddfkvedfqiegynphpti

SCOP Domain Coordinates for d2tsrc_:

Click to download the PDB-style file with coordinates for d2tsrc_.
(The format of our PDB-style files is described here.)

Timeline for d2tsrc_: