Lineage for d1bkob_ (1bko B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35325Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
  4. 35326Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 35327Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 35339Protein Thymidylate synthase [55833] (7 species)
  7. 35340Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries)
  8. 35349Domain d1bkob_: 1bko B: [41037]

Details for d1bkob_

PDB Entry: 1bko (more details), 2.75 Å

PDB Description: thermostable thymidylate synthase a from bacillus subtilis

SCOP Domain Sequences for d1bkob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkob_ d.117.1.1 (B:) Thymidylate synthase {Bacillus subtilis}
tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
apelwinpevkdfydftiddfklinykhgdkllfevav

SCOP Domain Coordinates for d1bkob_:

Click to download the PDB-style file with coordinates for d1bkob_.
(The format of our PDB-style files is described here.)

Timeline for d1bkob_: