Lineage for d2tdd__ (2tdd -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Lactobacillus casei [TaxId:1582] [55835] (39 PDB entries) 
Domain d2tdd__: 2tdd - [41021]
Details for d2tdd__
PDB Entry: 2tdd (more details), 2.7 Å
PDB Description: structures of thymidylate synthase with a c-terminal deletion: role of the c-terminus in alignment of d/ump and ch2h4folate
SCOP Domain Sequences for d2tdd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tdd__ d.117.1.1 (-) Thymidylate synthase {Lactobacillus casei}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapva
SCOP Domain Coordinates for d2tdd__:
Click to download the PDB-style file with coordinates for d2tdd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tdd__:
- d2tdd__ appears in SCOP 1.57
- d2tdd__ appears in the current release, SCOPe 2.08, called d2tdda_
View in 3D