Lineage for d5dt1h_ (5dt1 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742373Domain d5dt1h_: 5dt1 H: [409988]
    Other proteins in same PDB: d5dt1l1, d5dt1l2
    automated match to d6shgh_

Details for d5dt1h_

PDB Entry: 5dt1 (more details), 1.95 Å

PDB Description: crystal structure of human fab cap256-vrc26.25, a potent v1v2-directed hiv-1 broadly neutralizing antibody
PDB Compounds: (H:) Fab Heavy chain of broadly neutralizing antibody VRC26.25

SCOPe Domain Sequences for d5dt1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dt1h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesgggvvqpgtslrlscaasqfrfdgygmhwvrqapgkglewvasishdgikkyha
ekvwgrftisrdnskntlylqmnslrpedtalyycakdlredeceewwsdyydfgkqlpc
aksrgglvgiadnwgqgtmvtvssastkgpsvfplapsskstsggtaalgclvkdyfpep
vtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdk
rvepk

SCOPe Domain Coordinates for d5dt1h_:

Click to download the PDB-style file with coordinates for d5dt1h_.
(The format of our PDB-style files is described here.)

Timeline for d5dt1h_:

  • d5dt1h_ is new in SCOPe 2.08-stable