Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d5dt1h_: 5dt1 H: [409988] Other proteins in same PDB: d5dt1l1, d5dt1l2 automated match to d6shgh_ |
PDB Entry: 5dt1 (more details), 1.95 Å
SCOPe Domain Sequences for d5dt1h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dt1h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqlvesgggvvqpgtslrlscaasqfrfdgygmhwvrqapgkglewvasishdgikkyha ekvwgrftisrdnskntlylqmnslrpedtalyycakdlredeceewwsdyydfgkqlpc aksrgglvgiadnwgqgtmvtvssastkgpsvfplapsskstsggtaalgclvkdyfpep vtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdk rvepk
Timeline for d5dt1h_: