Lineage for d5dt1l2 (5dt1 L:106A-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750117Domain d5dt1l2: 5dt1 L:106A-210 [278380]
    Other proteins in same PDB: d5dt1h_, d5dt1l1
    automated match to d4ocrl2

Details for d5dt1l2

PDB Entry: 5dt1 (more details), 1.95 Å

PDB Description: crystal structure of human fab cap256-vrc26.25, a potent v1v2-directed hiv-1 broadly neutralizing antibody
PDB Compounds: (L:) Fab Light chain of broadly neutralizing antibody VRC26.25

SCOPe Domain Sequences for d5dt1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dt1l2 b.1.1.2 (L:106A-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvqpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d5dt1l2:

Click to download the PDB-style file with coordinates for d5dt1l2.
(The format of our PDB-style files is described here.)

Timeline for d5dt1l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dt1l1
View in 3D
Domains from other chains:
(mouse over for more information)
d5dt1h_