Lineage for d1f4db_ (1f4d B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261486Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 261487Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 261488Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 261500Protein Thymidylate synthase [55833] (7 species)
  7. 261515Species Escherichia coli [TaxId:562] [55834] (48 PDB entries)
  8. 261562Domain d1f4db_: 1f4d B: [40973]
    complexed with gol, sul, tp2; mutant

Details for d1f4db_

PDB Entry: 1f4d (more details), 2.15 Å

PDB Description: crystal structure of e. coli thymidylate synthase c146s, l143c covalently modified at c143 with n-[tosyl-d-prolinyl]amino- ethanethiol

SCOP Domain Sequences for d1f4db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4db_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmacapshaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOP Domain Coordinates for d1f4db_:

Click to download the PDB-style file with coordinates for d1f4db_.
(The format of our PDB-style files is described here.)

Timeline for d1f4db_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f4da_