Lineage for d1f4db_ (1f4d B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (39 PDB entries) 
Domain d1f4db_: 1f4d B: [40973]
Details for d1f4db_
PDB Entry: 1f4d (more details), 2.15 Å
PDB Description: crystal structure of e. coli thymidylate synthase c146s, l143c covalently modified at c143 with n-[tosyl-d-prolinyl]amino- ethanethiol
SCOP Domain Sequences for d1f4db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4db_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmacapshaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d1f4db_:
Click to download the PDB-style file with coordinates for d1f4db_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f4db_:
- d1f4db_ appears in SCOP 1.57
- d1f4db_ appears in the current release, SCOPe 2.08
View in 3D
