Lineage for d1aoba_ (1aob A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216602Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1216603Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 1216604Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1216637Protein Thymidylate synthase [55833] (7 species)
  7. 1216652Species Escherichia coli [TaxId:562] [55834] (65 PDB entries)
  8. 1216714Domain d1aoba_: 1aob A: [40969]
    complexed with ddu, fmt, po4

Details for d1aoba_

PDB Entry: 1aob (more details), 2.1 Å

PDB Description: e. coli thymidylate synthase complexed with ddurd
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1aoba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoba_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d1aoba_:

Click to download the PDB-style file with coordinates for d1aoba_.
(The format of our PDB-style files is described here.)

Timeline for d1aoba_: