SCOPe 2.03: Domain d1aoba_: 1aob A:

Lineage for d1aoba_ (1aob A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (63 PDB entries)

8. Domain d1aoba_: 1aob A: [40969]
   complexed with ddu, fmt, po4

Details for d1aoba_

PDB Entry: 1aob, 2.1 Å

PDB Description: e. coli thymidylate synthase complexed with ddurd

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1aoba_:

Sequence; same for both SEQRES and ATOM records:

>d1aoba_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d1aoba_:

• d1aoba_ first appeared (with stable ids) in SCOP 1.55, called d1aob__
  
• d1aoba_ appears in SCOPe 2.02
  
• d1aoba_ appears in SCOPe 2.04
  
• d1aoba_ appears in the current release, SCOPe 2.08