Lineage for d3wfeh_ (3wfe H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760798Domain d3wfeh_: 3wfe H: [408765]
    Other proteins in same PDB: d3wfel2
    automated match to d6shgh_
    complexed with 10m, ca, cyn, fe, hec, hem

Details for d3wfeh_

PDB Entry: 3wfe (more details), 2.49 Å

PDB Description: reduced and cyanide-bound cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment
PDB Compounds: (H:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d3wfeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wfeh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgtvlarpgasvkmsckasgysftsywmhwvkqrpgqglewigavypgnsdtsy
nqkfkgkakltavtsastaymelssltnedsavyycsrssldgyyvknwcfdvwgqgttv
tvssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpav
lqsdlytlsssvtvtsstrpsqsitcnvahpasstkvdkkieprg

SCOPe Domain Coordinates for d3wfeh_:

Click to download the PDB-style file with coordinates for d3wfeh_.
(The format of our PDB-style files is described here.)

Timeline for d3wfeh_:

  • d3wfeh_ is new in SCOPe 2.08-stable