SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wfel1 (3wfe L:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (535 PDB entries)
  8. 2028868Domain d3wfel1: 3wfe L:1-107 [265641]
    Other proteins in same PDB: d3wfel2
    automated match to d2fd6l1
    complexed with 10m, ca, cyn, fe, hec, hem

Details for d3wfel1

PDB Entry: 3wfe (more details), 2.49 Å

PDB Description: Reduced and cyanide-bound cytochrome c-dependent nitric oxide reductase (cNOR) from Pseudomonas aeruginosa in complex with antibody fragment
PDB Compounds: (L:) antibody fab fragment light chain

SCOPe Domain Sequences for d3wfel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wfel1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqsppylaaspgetitincrasksirkylawyqekpgktnklliysgstlqfgips
rfsgsgsgteftltisslepedfamyycqqhneypltfgagtklelk

SCOPe Domain Coordinates for d3wfel1:

Click to download the PDB-style file with coordinates for d3wfel1.
(The format of our PDB-style files is described here.)

Timeline for d3wfel1: