PDB entry 3wfe

View 3wfe on RCSB PDB site
Description: Reduced and cyanide-bound cytochrome c-dependent nitric oxide reductase (cNOR) from Pseudomonas aeruginosa in complex with antibody fragment
Class: immune system/oxidoreductase
Keywords: metal-binding, membrane protein, IMMUNE SYSTEM-OXIDOREDUCTASE complex
Deposited on 2013-07-18, released 2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Nitric oxide reductase subunit B
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nitric oxide reductase subunit C
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59646 (Start-145)
      • conflict (99)
  • Chain 'H':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WFE (0-224)
  • Chain 'L':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3WFE (0-212)
    Domains in SCOPe 2.07: d3wfel1, d3wfel2
  • Heterogens: HEM, FE, CYN, 10M, CA, HEC, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3wfeL (L:)
    diqmtqsppylaaspgetitincrasksirkylawyqekpgktnklliysgstlqfgips
    rfsgsgsgteftltisslepedfamyycqqhneypltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne