Lineage for d1pnea_ (1pne A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665313Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 1665314Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 1665315Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 1665329Species Cow (Bos taurus) [TaxId:9913] [55773] (5 PDB entries)
  8. 1665330Domain d1pnea_: 1pne A: [40866]

Details for d1pnea_

PDB Entry: 1pne (more details), 2 Å

PDB Description: crystallization and structure determination of bovine profilin at 2.0 angstroms resolution
PDB Compounds: (A:) Profilin

SCOPe Domain Sequences for d1pnea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnea_ d.110.1.1 (A:) Profilin (actin-binding protein) {Cow (Bos taurus) [TaxId: 9913]}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy

SCOPe Domain Coordinates for d1pnea_:

Click to download the PDB-style file with coordinates for d1pnea_.
(The format of our PDB-style files is described here.)

Timeline for d1pnea_: