| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
| Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
| Protein Profilin (actin-binding protein) [55772] (8 species) |
| Species Cow (Bos taurus) [TaxId:9913] [55773] (5 PDB entries) |
| Domain d1pnea_: 1pne A: [40866] |
PDB Entry: 1pne (more details), 2 Å
SCOPe Domain Sequences for d1pnea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnea_ d.110.1.1 (A:) Profilin (actin-binding protein) {Cow (Bos taurus) [TaxId: 9913]}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy
Timeline for d1pnea_: