PDB entry 1pne

View 1pne on RCSB PDB site
Description: crystallization and structure determination of bovine profilin at 2.0 angstroms resolution
Class: actin binding protein
Keywords: actin binding protein
Deposited on 1995-05-05, released 1995-07-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Profilin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02584 (0-138)
  Domains in SCOPe 2.04: d1pnea_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pneA (A:)
  agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
  ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
  gminkkcyemashlrrsqy