| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
| Protein Destrin [55767] (1 species) |
| Species Human and pig (Homo sapiens) and (Sus scrofa) [TaxId:9606] [55768] (2 PDB entries) identical sequence in both species |
| Domain d1ak7a_: 1ak7 A: [40864] |
PDB Entry: 1ak7 (more details)
SCOPe Domain Sequences for d1ak7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ak7a_ d.109.1.2 (A:) Destrin {Human and pig (Homo sapiens) and (Sus scrofa) [TaxId: 9606]}
tmitpssgnsasgvqvadevcrifydmkvrkcstpeeikkrkkavifclsadkkciivee
gkeilvgdvgvtitdpfkhfvgmlpekdcryalydasfetkesrkeelmfflwapelapl
kskmiyasskdaikkkfqgikhecqangpedlnraciaeklggslivafegcpv
Timeline for d1ak7a_: