Lineage for d1ahqa_ (1ahq A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665022Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1665023Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1665153Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 1665166Protein Cofilin (actin depolymerizing factor, ADF) [55763] (4 species)
  7. 1665167Species Acanthamoeba castellanii, actophorin [TaxId:5755] [55766] (2 PDB entries)
  8. 1665169Domain d1ahqa_: 1ahq A: [40863]

Details for d1ahqa_

PDB Entry: 1ahq (more details), 2.3 Å

PDB Description: recombinant actophorin
PDB Compounds: (A:) actophorin

SCOPe Domain Sequences for d1ahqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahqa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Acanthamoeba castellanii, actophorin [TaxId: 5755]}
giavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdcr
yaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatdaa
eisedavserakk

SCOPe Domain Coordinates for d1ahqa_:

Click to download the PDB-style file with coordinates for d1ahqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ahqa_: