![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
![]() | Protein Cofilin (actin depolymerizing factor, ADF) [55763] (4 species) |
![]() | Species Acanthamoeba castellanii, actophorin [TaxId:5755] [55766] (2 PDB entries) |
![]() | Domain d1ahqa_: 1ahq A: [40863] |
PDB Entry: 1ahq (more details), 2.3 Å
SCOPe Domain Sequences for d1ahqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahqa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Acanthamoeba castellanii, actophorin [TaxId: 5755]} giavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdcr yaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatdaa eisedavserakk
Timeline for d1ahqa_: