Lineage for d1ahq__ (1ahq -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) 
Family d.109.1.2: Cofilin-like [55762] (2 proteins) Protein Cofilin (actin depolymerizing factor, ADF) [55763] (3 species) 
Species Amoeba (Acanthamoeba castellanii), actophorin [55766] (2 PDB entries) 
Domain d1ahq__: 1ahq - [40863]
Details for d1ahq__
PDB Entry: 1ahq (more details), 2.3 Å
PDB Description: recombinant actophorin
SCOP Domain Sequences for d1ahq__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahq__ d.109.1.2 (-) Cofilin (actin depolymerizing factor, ADF) {Amoeba (Acanthamoeba castellanii), actophorin}
giavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdcr
yaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatdaa
eisedavserakk
SCOP Domain Coordinates for d1ahq__:
Click to download the PDB-style file with coordinates for d1ahq__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ahq__:
- d1ahq__ appears in SCOP 1.57
- d1ahq__ appears in the current release, SCOPe 2.08, called d1ahqa_
View in 3D