SCOPe 2.08: Domain d3qpqf1: 3qpq F:1-217

Lineage for d3qpqf1 (3qpq F:1-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3qpqf1: 3qpq F:1-217 [408624]
   Other proteins in same PDB: d3qpqc2, d3qpqd2, d3qpqe2, d3qpqf2, d3qpqh2, d3qpqi2, d3qpqj2, d3qpql2
   automated match to d6shgh_
   complexed with gol, so4

Details for d3qpqf1

PDB Entry: 3qpq, 1.9 Å

PDB Description: crystal structure of anti-tlr3 antibody c1068 fab

PDB Compounds: (F:) C1068 heavy chain

SCOPe Domain Sequences for d3qpqf1:

Sequence, based on SEQRES records:

>d3qpqf1 b.1.1.0 (F:1-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlqqpgaelvqpgtsvrlsckasgyifttywihwvkqrpgqglewigeinpnngriny
nekfktkatltvdkssstaymqlssltsedsavyyctrvgvmittfpywgqgtlvtvsaa
stkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtktytcnvdhkpsntkvdkrv

Sequence, based on observed residues (ATOM records):

>d3qpqf1 b.1.1.0 (F:1-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlqqpgaelvqpgtsvrlsckasgyifttywihwvkqrpgqglewigeinpnngriny
nekfktkatltvdkssstaymqlssltsedsavyyctrvgvmittfpywgqgtlvtvsaa
stkgpsvfplapcstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtktytcnvdhkpsntkvdkrv

Timeline for d3qpqf1:

• d3qpqf1 is new in SCOPe 2.08-stable