SCOPe 2.08: Domain d3qpqi1: 3qpq I:1-107

Lineage for d3qpqi1 (3qpq I:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3qpqi1: 3qpq I:1-107 [215353]
   Other proteins in same PDB: d3qpqc2, d3qpqd2, d3qpqe2, d3qpqf2, d3qpqh2, d3qpqi2, d3qpqj2, d3qpql2
   automated match to d1rhha1
   complexed with gol, so4

Details for d3qpqi1

PDB Entry: 3qpq, 1.9 Å

PDB Description: crystal structure of anti-tlr3 antibody c1068 fab

PDB Compounds: (I:) C1068 light chain

SCOPe Domain Sequences for d3qpqi1:

Sequence; same for both SEQRES and ATOM records:

>d3qpqi1 b.1.1.0 (I:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsgsesgtqyslkinslqpedfgsyycqhfwstpftfgsgtklelk

Timeline for d3qpqi1:

• d3qpqi1 first appeared in SCOPe 2.03
  
• d3qpqi1 appears in SCOPe 2.07