Lineage for d3qpql2 (3qpq L:108-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750439Domain d3qpql2: 3qpq L:108-215 [215356]
    Other proteins in same PDB: d3qpqc1, d3qpqd1, d3qpqd2, d3qpqe1, d3qpqf1, d3qpqf2, d3qpqh1, d3qpqh2, d3qpqi1, d3qpqj1, d3qpqj2, d3qpql1
    automated match to d1rhha2
    complexed with gol, so4

Details for d3qpql2

PDB Entry: 3qpq (more details), 1.9 Å

PDB Description: crystal structure of anti-tlr3 antibody c1068 fab
PDB Compounds: (L:) C1068 light chain

SCOPe Domain Sequences for d3qpql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qpql2 b.1.1.2 (L:108-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d3qpql2:

Click to download the PDB-style file with coordinates for d3qpql2.
(The format of our PDB-style files is described here.)

Timeline for d3qpql2: