Lineage for d1cof__ (1cof -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) 
Family d.109.1.2: Cofilin-like [55762] (2 proteins) Protein Cofilin (actin depolymerizing factor, ADF) [55763] (3 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55765] (3 PDB entries) 
Domain d1cof__: 1cof - [40860]
Details for d1cof__
PDB Entry: 1cof (more details), 2.3 Å
PDB Description: yeast cofilin, orthorhombic crystal form
SCOP Domain Sequences for d1cof__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cof__ d.109.1.2 (-) Cofilin (actin depolymerizing factor, ADF) {Baker's yeast (Saccharomyces cerevisiae)}
vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs
evsydsvlervsrga
SCOP Domain Coordinates for d1cof__:
Click to download the PDB-style file with coordinates for d1cof__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cof__:
- d1cof__ appears in SCOP 1.57
- d1cof__ appears in the current release, SCOPe 2.08, called d1cofa_
View in 3D