![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (2 proteins) |
![]() | Protein Cofilin (actin depolymerizing factor, ADF) [55763] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55765] (3 PDB entries) |
![]() | Domain d1cof__: 1cof - [40860] |
PDB Entry: 1cof (more details), 2.3 Å
SCOP Domain Sequences for d1cof__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cof__ d.109.1.2 (-) Cofilin (actin depolymerizing factor, ADF) {Baker's yeast (Saccharomyces cerevisiae)} vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs evsydsvlervsrga
Timeline for d1cof__: