Lineage for d1esvs_ (1esv S:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35145Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 35146Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 35147Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 35148Protein Gelsolin [55759] (2 species)
  7. 35162Species Human (Homo sapiens) [TaxId:9606] [55761] (9 PDB entries)
  8. 35169Domain d1esvs_: 1esv S: [40852]
    Other proteins in same PDB: d1esva1, d1esva2

Details for d1esvs_

PDB Entry: 1esv (more details), 2 Å

PDB Description: complex between latrunculin a:rabbit muscle alpha actin:human gelsolin domain 1

SCOP Domain Sequences for d1esvs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esvs_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens)}
mvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgf

SCOP Domain Coordinates for d1esvs_:

Click to download the PDB-style file with coordinates for d1esvs_.
(The format of our PDB-style files is described here.)

Timeline for d1esvs_: