Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) |
Family d.109.1.1: Gelsolin-like [55754] (3 proteins) |
Protein Gelsolin [55759] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55761] (11 PDB entries) |
Domain d1c0fs_: 1c0f S: [40851] Other proteins in same PDB: d1c0fa1, d1c0fa2 |
PDB Entry: 1c0f (more details), 2.4 Å
SCOP Domain Sequences for d1c0fs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0fs_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens)} mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk ggvasgf
Timeline for d1c0fs_: