Lineage for d1c0fs_ (1c0f S:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35145Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 35146Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 35147Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 35148Protein Gelsolin [55759] (2 species)
  7. 35162Species Human (Homo sapiens) [TaxId:9606] [55761] (9 PDB entries)
  8. 35168Domain d1c0fs_: 1c0f S: [40851]
    Other proteins in same PDB: d1c0fa1, d1c0fa2

Details for d1c0fs_

PDB Entry: 1c0f (more details), 2.4 Å

PDB Description: crystal structure of dictyostelium caatp-actin in complex with gelsolin segment 1

SCOP Domain Sequences for d1c0fs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0fs_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens)}
mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq
ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk
ggvasgf

SCOP Domain Coordinates for d1c0fs_:

Click to download the PDB-style file with coordinates for d1c0fs_.
(The format of our PDB-style files is described here.)

Timeline for d1c0fs_: