SCOP 1.59: Domain d1c0fa1: 1c0f A:1-146

Lineage for d1c0fa1 (1c0f A:1-146)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families)

5. Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)

6. Protein Actin [53073] (5 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (4 PDB entries)

8. Domain d1c0fa1: 1c0f A:1-146 [33447]
   Other proteins in same PDB: d1c0fs_

Details for d1c0fa1

PDB Entry: 1c0f, 2.4 Å

PDB Description: crystal structure of dictyostelium caatp-actin in complex with gelsolin segment 1

SCOP Domain Sequences for d1c0fa1:

Sequence; same for both SEQRES and ATOM records:

>d1c0fa1 c.55.1.1 (A:1-146) Actin {Slime mold (Dictyostelium discoideum)}
dgedvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg

Timeline for d1c0fa1:

• d1c0fa1 first appeared (with stable ids) in SCOP 1.55
  
• d1c0fa1 appears in SCOP 1.57
  
• d1c0fa1 appears in SCOP 1.61
  
• d1c0fa1 appears in the current release, SCOPe 2.08