Lineage for d1c0fa1 (1c0f A:1-146)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124261Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 124262Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 124263Protein Actin [53073] (5 species)
  7. 124288Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (4 PDB entries)
  8. 124291Domain d1c0fa1: 1c0f A:1-146 [33447]
    Other proteins in same PDB: d1c0fs_

Details for d1c0fa1

PDB Entry: 1c0f (more details), 2.4 Å

PDB Description: crystal structure of dictyostelium caatp-actin in complex with gelsolin segment 1

SCOP Domain Sequences for d1c0fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0fa1 c.55.1.1 (A:1-146) Actin {Slime mold (Dictyostelium discoideum)}
dgedvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg

SCOP Domain Coordinates for d1c0fa1:

Click to download the PDB-style file with coordinates for d1c0fa1.
(The format of our PDB-style files is described here.)

Timeline for d1c0fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c0fa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1c0fs_