Lineage for d1c0fa1 (1c0f A:1-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883386Protein Actin [53073] (10 species)
  7. 2883652Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (7 PDB entries)
  8. 2883661Domain d1c0fa1: 1c0f A:1-146 [33447]
    Other proteins in same PDB: d1c0fs_
    complexed with atp, ca

Details for d1c0fa1

PDB Entry: 1c0f (more details), 2.4 Å

PDB Description: crystal structure of dictyostelium caatp-actin in complex with gelsolin segment 1
PDB Compounds: (A:) actin

SCOPe Domain Sequences for d1c0fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0fa1 c.55.1.1 (A:1-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dgedvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg

SCOPe Domain Coordinates for d1c0fa1:

Click to download the PDB-style file with coordinates for d1c0fa1.
(The format of our PDB-style files is described here.)

Timeline for d1c0fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c0fa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1c0fs_