![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Actin [53073] (10 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (7 PDB entries) |
![]() | Domain d1c0fa1: 1c0f A:1-146 [33447] Other proteins in same PDB: d1c0fs_ complexed with atp, ca |
PDB Entry: 1c0f (more details), 2.4 Å
SCOPe Domain Sequences for d1c0fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0fa1 c.55.1.1 (A:1-146) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} dgedvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltl kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf ntpamyvaiqavlslyasg
Timeline for d1c0fa1: