PDB entry 1c0f

View 1c0f on RCSB PDB site
Description: crystal structure of dictyostelium caatp-actin in complex with gelsolin segment 1
Class: contractile protein
Keywords: ca actin, contractile protein
Deposited on 1999-07-16, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.183
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actin
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07830 (0-367)
      • modified residue (65)
    Domains in SCOPe 2.07: d1c0fa1, d1c0fa2
  • Chain 'S':
    Compound: gelsolin segment 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06396 (3-126)
      • expression artifact (0-2)
      • engineered (34)
    Domains in SCOPe 2.07: d1c0fs_
  • Heterogens: CA, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0fA (A:)
    dgedvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltl
    kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
    ntpamyvaiqavlslyasgrttgivmdsgdgvshtvpiyegyalphailrldlagrdltd
    ymmkiltergysftttaereivrdikeklayvaldfeaemqtaasssaleksyelpdgqv
    itignerfrcpealfqpsflgmesagihettynsimkcdvdirkdlygnvvlsggttmfp
    giadrmnkeltalapstmkikiiapperkysvwiggsilaslstfqqmwiskeeydesgp
    sivhrkcf
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0fS (S:)
    mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq
    ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk
    ggvasgf