Lineage for d1d0nb5 (1d0n B:533-628)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35145Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 35146Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 35147Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 35148Protein Gelsolin [55759] (2 species)
  7. 35149Species Horse (Equus caballus) [TaxId:9796] [55760] (1 PDB entry)
  8. 35160Domain d1d0nb5: 1d0n B:533-628 [40844]

Details for d1d0nb5

PDB Entry: 1d0n (more details), 2.5 Å

PDB Description: the crystal structure of calcium-free equine plasma gelsolin.

SCOP Domain Sequences for d1d0nb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0nb5 d.109.1.1 (B:533-628) Gelsolin {Horse (Equus caballus)}
pastrlfqvrasssgatraveiipkagalnsndafvlktpsaaylwvgagaseaektgaq
ellrvlraqpvqvaegsepdsfwealggkatyrtsp

SCOP Domain Coordinates for d1d0nb5:

Click to download the PDB-style file with coordinates for d1d0nb5.
(The format of our PDB-style files is described here.)

Timeline for d1d0nb5: