Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) |
Family d.109.1.1: Gelsolin-like [55754] (3 proteins) |
Protein Gelsolin [55759] (2 species) |
Species Horse (Equus caballus) [TaxId:9796] [55760] (1 PDB entry) |
Domain d1d0nb5: 1d0n B:533-628 [40844] |
PDB Entry: 1d0n (more details), 2.5 Å
SCOP Domain Sequences for d1d0nb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0nb5 d.109.1.1 (B:533-628) Gelsolin {Horse (Equus caballus)} pastrlfqvrasssgatraveiipkagalnsndafvlktpsaaylwvgagaseaektgaq ellrvlraqpvqvaegsepdsfwealggkatyrtsp
Timeline for d1d0nb5: