Lineage for d1nmtb1 (1nmt B:60-224)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35089Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 35090Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 35133Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
  6. 35134Protein N-myristoyl transferase, NMT [55749] (2 species)
  7. 35138Species Yeast (Candida albicans) [TaxId:5476] [55751] (1 PDB entry)
  8. 35141Domain d1nmtb1: 1nmt B:60-224 [40825]

Details for d1nmtb1

PDB Entry: 1nmt (more details), 2.45 Å

PDB Description: n-myristoyl transferase from candida albicans at 2.45 a

SCOP Domain Sequences for d1nmtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmtb1 d.108.1.2 (B:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans)}
egpidklktpedvpndplplisdfewstldiddnlqldelykllydnyvedidatfrfky
sheffqwalkppgwrkdwhvgvrvkstgklvafiaatpvtfklnksnkvidsveinflci
hkklrnkrlapvlikeitrrvnkqniwqalytggsilptplttcr

SCOP Domain Coordinates for d1nmtb1:

Click to download the PDB-style file with coordinates for d1nmtb1.
(The format of our PDB-style files is described here.)

Timeline for d1nmtb1: