Lineage for d1qsmd_ (1qsm D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35089Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 35090Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 35091Family d.108.1.1: N-acetyl transferase, NAT [55730] (8 proteins)
  6. 35118Protein Histone acetyltransferase HPA2 [55740] (1 species)
  7. 35119Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55741] (2 PDB entries)
  8. 35123Domain d1qsmd_: 1qsm D: [40811]

Details for d1qsmd_

PDB Entry: 1qsm (more details), 2.4 Å

PDB Description: Histone Acetyltransferase HPA2 from Saccharomyces Cerevisiae in Complex with Acetyl Coenzyme A

SCOP Domain Sequences for d1qsmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsmd_ d.108.1.1 (D:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae)}
sednitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavaves
ssekiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsv
ywctdesnhraqllyvkvgykapkilykrkgy

SCOP Domain Coordinates for d1qsmd_:

Click to download the PDB-style file with coordinates for d1qsmd_.
(The format of our PDB-style files is described here.)

Timeline for d1qsmd_: