SCOP 1.57: Domain d12asb_: 12as B:

Lineage for d12asb_ (12as B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins)

6. Protein Asparagine synthetase [55705] (1 species)

7. Species Escherichia coli [TaxId:562] [55706] (2 PDB entries)

8. Domain d12asb_: 12as B: [40784]

Details for d12asb_

PDB Entry: 12as, 2.2 Å

PDB Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine and amp

SCOP Domain Sequences for d12asb_:

Sequence; same for both SEQRES and ATOM records:

>d12asb_ d.104.1.1 (B:) Asparagine synthetase {Escherichia coli}
ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
llqlphigqvqagvwpaavresvpsll

Timeline for d12asb_:

• d12asb_ first appeared (with stable ids) in SCOP 1.55
  
• d12asb_ appears in SCOP 1.59
  
• d12asb_ appears in the current release, SCOPe 2.08