Lineage for d12asb_ (12as B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. Protein Asparagine synthetase [55705] (1 species)
  7. Species Escherichia coli [TaxId:562] [55706] (2 PDB entries)
  8. Domain d12asb_: 12as B: [40784]
    complexed with amp, asn; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d12asb_

PDB Entry: 12as (more details), 2.2 Å

PDB Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine and amp
PDB Compounds: (B:) asparagine synthetase

SCOPe Domain Sequences for d12asb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d12asb_ d.104.1.1 (B:) Asparagine synthetase {Escherichia coli [TaxId: 562]}
ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
llqlphigqvqagvwpaavresvpsll

SCOPe Domain Coordinates for d12asb_ are not available.

Timeline for d12asb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d12asa_