PDB entry 12as

View 12as on RCSB PDB site
Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine and amp
Deposited on 1997-12-02, released 1998-12-30
The last revision prior to the SCOP 1.57 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.164
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d12asa_
  • Chain 'B':
    Domains in SCOP 1.57: d12asb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >12asA (A:)
    ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
    daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
    gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
    greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
    edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
    llqlphigqvqagvwpaavresvpsll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >12asB (B:)
    ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
    daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
    gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
    greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
    edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
    llqlphigqvqagvwpaavresvpsll